PDB entry 3zqa

View 3zqa on RCSB PDB site
Description: crystallographic structure of betaine aldehyde dehydrogenase mutant c286a from pseudomonas aeruginosa in complex with nadph
Class: oxidoreductase
Keywords: aldehyde oxidation, nadph complex, oxidoreductase
Deposited on 2011-06-08, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.1569
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (285)
    Domains in SCOPe 2.07: d3zqaa_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (285)
    Domains in SCOPe 2.07: d3zqab_
  • Chain 'C':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (285)
    Domains in SCOPe 2.07: d3zqac_
  • Chain 'D':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (Start-489)
      • engineered mutation (285)
    Domains in SCOPe 2.07: d3zqad_
  • Heterogens: GOL, PG4, EDO, NDP, K, TOE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zqaA (A:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zqaA (A:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zqaB (B:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zqaB (B:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zqaC (C:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zqaC (C:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zqaD (D:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zqaD (D:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf