PDB entry 3zoo

View 3zoo on RCSB PDB site
Description: Structure of the Y46F mutant of human cytochrome c
Class: oxidoreductase
Keywords: oxidoreductase, respiration, apoptosis, electron transfer
Deposited on 2013-02-22, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d3zooa_
  • Chain 'B':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d3zoob_
  • Chain 'C':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d3zooc_
  • Chain 'D':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d3zood_
  • Heterogens: HEC, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zooA (A:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgfsytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zooB (B:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgfsytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zooC (C:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgfsytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zooD (D:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgfsytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne