PDB entry 3zo0

View 3zo0 on RCSB PDB site
Description: Mouse IgG2a in complex with mouse TRIM21 PRYSPRY
Class: immune system/ligase
Keywords: immune system-ligase complex
Deposited on 2013-02-19, released 2013-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.18474
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig gamma-2a chain c region, a allele
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01863 (0-207)
      • conflict (207)
    Domains in SCOPe 2.07: d3zo0a1, d3zo0a2
  • Chain 'B':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62191 (2-End)
      • expression tag (0-1)
      • conflict (100)
    Domains in SCOPe 2.07: d3zo0b1, d3zo0b2
  • Heterogens: MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zo0A (A:)
    gpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredy
    nstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppee
    emtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekkn
    wvernsyscsvvheglhnhhttksfsrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zo0B (B:)
    hmvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmyw
    evdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppc
    qigifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl
    km
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zo0B (B:)
    hmvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmyw
    evdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppc
    qigifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl