PDB entry 3znc

View 3znc on RCSB PDB site
Description: murine carbonic anhydrase IV complexed with brinzolamide
Class: lyase
Keywords: lyase, zinc, murine, membrane, inhibitor
Deposited on 1998-02-10, released 1999-03-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase IV
    Species: Mus musculus [TaxId:10090]
    Gene: MURINE CAIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64444 (0-257)
      • conflict (6)
    Domains in SCOPe 2.03: d3znca_
  • Heterogens: ZN, BZ1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zncA (A:)
    wcyeiqtedprssclgpekwpgackenqqspinivtartkvnprltpfilvgydqkqqwp
    iknnqhtvemtlgggaciiggdlparyeavqlhlhwsngndngsehsidgrhfamemhiv
    hkkltsskedskdkfavlafmievgdkvnkgfqplvealpsiskphststvresslqdml
    ppstkmytyfryngslttpncdetviwtvykqpikihknqflefsknlyydedqklnmkd
    nvrplqplgkrqvfksha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zncA (A:)
    wcyeiqtedprssclgpekwpgackenqqspinivtartkvnprltpfilvgydqkqqwp
    iknnqhtvemtlgggaciiggdlparyeavqlhlhwsngndngsehsidgrhfamemhiv
    hkkldkfavlafmievgdkvnkgfqplvealpsiskphststvresslqdmlppstkmyt
    yfryngslttpncdetviwtvykqpikihknqflefsknlyydedqklnmkdnvrplqpl
    gkrqvfksha