PDB entry 3zmc

View 3zmc on RCSB PDB site
Description: Native structure of Farnesyl Pyrophosphate Synthase from Pseudomonas aeruginosa PA01, with bound substrate molecule Geranyl pyrophosphate.
Class: transferase
Keywords: transferase
Deposited on 2013-02-07, released 2014-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zmca_
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3zmcb1, d3zmcb2
  • Heterogens: GPP, MG, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zmcA (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zmcA (A:)
    miaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealgg
    apqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqala
    fevladtrrnpqehavclemltrlaraagsagmvggqaidlgsldqaalevmhrhktgal
    ieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaakgyal
    elrdlalaaldgfppsadplrqlaryiverr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zmcB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zmcB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaa
    kgyalelrdlalaaldgfppsadplrqlaryiv