PDB entry 3zmb

View 3zmb on RCSB PDB site
Description: Native structure of Farnesyl Pyrophosphate Synthase from Pseudomonas aeruginosa PA01, with bound fragment SPB02696.
Class: transferase
Keywords: transferase, maybridge fragment library
Deposited on 2013-02-07, released 2014-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3zmba1, d3zmba2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3zmbb1, d3zmbb2
  • Heterogens: 6H6, DMS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zmbA (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zmbA (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvaldqaalevmhrhkt
    galieasvrlgalasgraepaslaaleryaeaiglafqvqddildveptypallgleaak
    gyalelrdlalaaldgfppsadplrqlaryiverr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zmbB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zmbB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildveptypallglea
    akgyalelrdlalaaldgfppsadplrqlaryiv