PDB entry 3zl6

View 3zl6 on RCSB PDB site
Description: Native structure of Farnesyl Pyrophosphate Synthase from Pseudomonas aeruginosa PAO1, with bound fragment KM10833.
Class: transferase
Keywords: transferase, km10833, maybridge fragment library
Deposited on 2013-01-28, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3zl6a1, d3zl6a2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3zl6b1, d3zl6b2
  • Heterogens: DMS, MG, NVU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zl6A (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zl6A (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsaldqaalevmhrhktg
    alieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaakgy
    alelrdlalaaldgfppsadplrqlaryiverr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zl6B (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zl6B (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaa
    kgyalelrdlalaaldgfppsadplrqlaryive