PDB entry 3zl4

View 3zl4 on RCSB PDB site
Description: Antibody structural organization: Role of kappa - lambda chain constant domain switch in catalytic functionality
Class: immune system
Keywords: immune system
Deposited on 2013-01-28, released 2014-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2077
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: a17 antibody fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZL4 (0-End)
  • Chain 'L':
    Compound: a17 antibody fab fragment lambda light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZL4
    Domains in SCOPe 2.04: d3zl4l1, d3zl4l2
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3zl4L (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslnpvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecsgidaaaaasfleqkliseedlnsav
    dhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zl4L (L:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslnpvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecsg