PDB entry 3zkx

View 3zkx on RCSB PDB site
Description: ternary bace2 xaperone complex
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-01-25, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.1861
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5Z0
      • engineered mutation (256)
    Domains in SCOPe 2.07: d3zkxa_
  • Chain 'B':
    Compound: xa4813
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZKX (0-End)
    Domains in SCOPe 2.07: d3zkxb1, d3zkxb2
  • Chain 'C':
    Compound: xa4815
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZKX
    Domains in SCOPe 2.07: d3zkxc1, d3zkxc2
  • Heterogens: CL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zkxA (A:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipafsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zkxA (A:)
    lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
    yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
    glayatlakpsssletffdslvtqanipnvfsmqmcgaglggslvlggiepslykgdiwy
    tpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveavar
    aslipafsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpml
    nyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisgpfs
    tedvasncvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zkxB (B:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshhhhhhep
    ea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zkxB (B:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zkxC (C:)
    qvqlqesggglvqaggslrlscaasgftfsraamrwvrraperglewvaninagdgsasy
    adfvkgrftasrdkagnrlylqmdnlrpndtavyyciynghrgqgtqvtvsshhhhhhep
    ea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zkxC (C:)
    lqesggglvqaggslrlscaasgftfsraamrwvrraperglewvaninagdgsasyadf
    vkgrftasrdkagnrlylqmdnlrpndtavyyciynghrgqgtqvtvsshh