PDB entry 3zkj

View 3zkj on RCSB PDB site
Description: Crystal Structure of Ankyrin Repeat and Socs Box-Containing Protein 9 (Asb9) in Complex with Elonginb and Elonginc
Class: transcription
Keywords: transcription, transcription regulation, autoantibody
Deposited on 2013-01-23, released 2013-01-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.2289
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ankyrin repeat and socs box protein 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3zkjb_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ankyrin repeat and socs box protein 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zkjB (B:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zkjB (B:)
    yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsei
    pefpiapeialellmaanfldc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.