PDB entry 3zkj
View 3zkj on RCSB PDB site
Description: Crystal Structure of Ankyrin Repeat and Socs Box-Containing Protein 9 (Asb9) in Complex with Elonginb and Elonginc
Class: transcription
Keywords: transcription, transcription regulation, autoantibody
Deposited on
2013-01-23, released
2013-01-30
The last revision prior to the SCOPe 2.02 freeze date was dated
2013-01-30, with a file datestamp of
2013-01-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.2289
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ankyrin repeat and socs box protein 9
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Transcription elongation factor B polypeptide 1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3zkjb_ - Chain 'C':
Compound: Transcription elongation factor B polypeptide 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: ankyrin repeat and socs box protein 9
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Transcription elongation factor B polypeptide 1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Transcription elongation factor B polypeptide 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Heterogens: EDO, PEG, CL, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3zkjB (B:)
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
Sequence, based on observed residues (ATOM records): (download)
>3zkjB (B:)
yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsei
pefpiapeialellmaanfldc
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.