PDB entry 3zj7

View 3zj7 on RCSB PDB site
Description: Crystal structure of strictosidine glucosidase in complex with inhibitor-1
Class: hydrolase
Keywords: hydrolase, alkaloid, inhibitor, ajmaline
Deposited on 2013-01-17, released 2014-02-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: strictosidine-o-beta-d-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zj7a_
  • Chain 'B':
    Compound: strictosidine-o-beta-d-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zj7b_
  • Heterogens: C1K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zj7A (A:)
    mdntqaeplvvaivpkpnastehtnshlipvtrskivvhrrdfpqdfifgaggsayqceg
    aynegnrgpsiwdtftqrspakisdgsngnqaincyhmykedikimkqtglesyrfsisw
    srvlpggrlaagvnkdgvkfyhdfidellangikpsvtlfhwdlpqaledeyggflshri
    vddfceyaefcfwefgdkikywttfnephtfavngyalgefapgrggkgdegdpaiepyv
    vthnillahkaaveeyrnkfqkcqegeigivlnsmwmeplsdvqadidaqkraldfmlgw
    fleplttgdypksmrelvkgrlpkfsaddseklkgcydfigmnyytatyvtnavksnsek
    lsyetddqvtktfernqkpighalyggwqhvvpwglykllvytketyhvpvlyvtesgmv
    eenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfvwsffdnfewnlgyicr
    ygiihvdyksferypkesaiwyknfiagksttspakrrreeaqvelvkrqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zj7A (A:)
    vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincy
    hmykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikps
    vtlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngy
    algefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmw
    meplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgc
    ydfigmnyytatyvtnavklsyetddqvtktfernqkpighalyggwqhvvpwglykllv
    ytketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgvnvkg
    yfvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zj7B (B:)
    mdntqaeplvvaivpkpnastehtnshlipvtrskivvhrrdfpqdfifgaggsayqceg
    aynegnrgpsiwdtftqrspakisdgsngnqaincyhmykedikimkqtglesyrfsisw
    srvlpggrlaagvnkdgvkfyhdfidellangikpsvtlfhwdlpqaledeyggflshri
    vddfceyaefcfwefgdkikywttfnephtfavngyalgefapgrggkgdegdpaiepyv
    vthnillahkaaveeyrnkfqkcqegeigivlnsmwmeplsdvqadidaqkraldfmlgw
    fleplttgdypksmrelvkgrlpkfsaddseklkgcydfigmnyytatyvtnavksnsek
    lsyetddqvtktfernqkpighalyggwqhvvpwglykllvytketyhvpvlyvtesgmv
    eenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfvwsffdnfewnlgyicr
    ygiihvdyksferypkesaiwyknfiagksttspakrrreeaqvelvkrqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zj7B (B:)
    vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincy
    hmykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikps
    vtlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngy
    algefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmw
    meplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgc
    ydfigmnyytatyvtnavklsyetddqvtktfernqkpighalyggwqhvvpwglykllv
    ytketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgvnvkg
    yfvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiag