PDB entry 3zj6

View 3zj6 on RCSB PDB site
Description: Crystal of Raucaffricine Glucosidase in complex with inhibitor
Class: hydrolase
Keywords: hydrolase, rg, inhibitor, alkaloid
Deposited on 2013-01-17, released 2014-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zj6a_
  • Chain 'B':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zj6b_
  • Heterogens: SO4, VM2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zj6A (A:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnepwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhknisklpavkrsireddeeqvsskrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zj6A (A:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfsv
    hgyatglyapgrgrtgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatqw
    mepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlkg
    sydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkil
    vytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvk
    gyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zj6B (B:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnepwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhknisklpavkrsireddeeqvsskrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zj6B (B:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfsv
    hgyatglyapgrgrtgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatqw
    mepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlkg
    sydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkil
    vytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvk
    gyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk