PDB entry 3zhl

View 3zhl on RCSB PDB site
Description: The crystal structure of single domain antibody 8-14 scaffold
Class: immune system
Keywords: immune system, single domain antibody
Deposited on 2012-12-22, released 2014-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.194
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mg8-14 scaffold antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZHL (0-End)
    Domains in SCOPe 2.07: d3zhla1, d3zhla2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zhlA (A:)
    evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpewvslisgsggstwy
    ddsvkgrftisrdnsknllylqmnslraedtavyycarhapsteapdywgqgtlvtvssl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zhlA (A:)
    evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpewvslisgsggstwy
    ddsvkgrftisrdnsknllylqmnslraedtavyycarhapsteapdywgqgtlvtvssl
    e