PDB entry 3zhg

View 3zhg on RCSB PDB site
Description: Crystallographic structure of the native mouse SIGN-R1 CRD domain
Class: immune system
Keywords: c-lectin crd, immune system, capsular polysaccharide.
Deposited on 2012-12-21, released 2014-01-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.2072
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3zhgb_
  • Chain 'C':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3zhgd_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zhgB (B:)
    msallilalvgaavadykddddklcrlcpwdwtfllgncyffsksqrnwndavtackevk
    aqlviinsdeeqtflqqtskakgptwmglsdlkkeatwlwvdgstlssrfqkywnrgepn
    nigeedcvefagdgwndskcelkkfwickksatpcteg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zhgB (B:)
    lcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakg
    ptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelk
    kfwickksatpc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zhgD (D:)
    msallilalvgaavadykddddrlcrlcpwdwtfllgncyffsksqrnwndavtackevk
    aqlviinsdeeqtflqqtskakgptwmglsdlkkeatwlwvdgstlssrfqkywnrgepn
    nigeedcvefagdgwndskcelkkfwickksatpcteg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zhgD (D:)
    rlcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskak
    gptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcel
    kkfwickksatpc