PDB entry 3zhd

View 3zhd on RCSB PDB site
Description: The crystal structure of single domain antibody 8-4 scaffold.
Class: immune system
Keywords: immune system, single domain antibody
Deposited on 2012-12-21, released 2014-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.1806
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mg8-4 scaffold antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZHD (0-End)
    Domains in SCOPe 2.07: d3zhda1, d3zhda2
  • Chain 'B':
    Compound: mg8-4 scaffold antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZHD (0-End)
    Domains in SCOPe 2.07: d3zhdb1, d3zhdb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zhdA (A:)
    evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy
    ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvssl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zhdA (A:)
    evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy
    ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvssl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zhdB (B:)
    evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy
    ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvssl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zhdB (B:)
    evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy
    ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvssl