PDB entry 3zg0

View 3zg0 on RCSB PDB site
Description: Crystal structure of ceftaroline acyl-PBP2a from MRSA with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by cocrystallization
Class: hydrolase
Keywords: hydrolase, mrsa, allosteric site, b-lactam antibiotics
Deposited on 2012-12-13, released 2013-10-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1885
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3zg0a1, d3zg0a2, d3zg0a3
  • Chain 'B':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3zg0b1, d3zg0b2, d3zg0b3
  • Heterogens: AI8, CD, CL, 1W8, MUR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zg0A (A:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpn
    mmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zg0B (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpn
    mmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zg0B (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelkrqigwfisydkdnpnmmmainv
    kdvqdkgmasynakisgkvydelyengnkkydide