PDB entry 3zfc

View 3zfc on RCSB PDB site
Description: Crystal Structure of the Kif4 Motor Domain Complexed With Mg-AMPPNP
Class: hydrolase
Keywords: hydrolase, molecular motor, ATPase, microtubule
Deposited on 2012-12-11, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17222
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromosome-associated kinesin kif4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33174 (Start-343)
      • expression tag (344-346)
    Domains in SCOPe 2.07: d3zfca1, d3zfca2
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zfcA (A:)
    mkeevkgipvrvalrcrplvskeikegcqtclsfvpgepqvvvgndksftydfvfdpste
    qeevfntavaplikgvfkgynatvlaygqtgsgktysmggaytaeqehdsaigviprviq
    llfkeinkksdfeftlkvsyleiyneeildllcssrekatqiniredpkegikivgltek
    tvlvasdtvscleqgnnsrtvastamnsqssrshaiftisieqrkkndknssfrsklhlv
    dlagserqkktkaegdrlregininrgllclgnvisalgddkkgnfvpyrdskltrllqd
    slggnshtlmiacvspadsnleetlntlryadrarkiknkpiinhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zfcA (A:)
    vkgipvrvalrcrplvskeikegcqtclsfvpgepqvvvgndksftydfvfdpsteqeev
    fntavaplikgvfkgynatvlaygqtgsgktysmggaytaeqehdsaigviprviqllfk
    einkksdfeftlkvsyleiyneeildllcsqiniredpkegikivgltektvlvasdtvs
    cleqgnnsrtvastamnsqssrshaiftisieqrkkndknssfrsklhlvdlagserqkk
    tkaegdrlregininrgllclgnvisalgddkkgnfvpyrdskltrllqdslggnshtlm
    iacvspadsnleetlntlryadrarkiknkpiinhhh