PDB entry 3zdx

View 3zdx on RCSB PDB site
Description: Integrin alphaIIB beta3 headpiece and RGD peptide complex
Class: cell adhesion/immune system
Keywords: cell adhesion-immune system complex
Deposited on 2012-12-03, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.163
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha-IIb
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdxa_
  • Chain 'B':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: integrin alpha-IIb
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdxc_
  • Chain 'D':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 10e5 fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZDX (0-End)
  • Chain 'F':
    Compound: 10e5 fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZDX (0-213)
    Domains in SCOPe 2.07: d3zdxf1, d3zdxf2
  • Chain 'H':
    Compound: 10e5 fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZDX (0-End)
  • Chain 'L':
    Compound: 10e5 fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZDX (0-213)
    Domains in SCOPe 2.07: d3zdxl1, d3zdxl2
  • Heterogens: GOL, SO4, CA, CL, MN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zdxA (A:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqpvvkas
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zdxC (C:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqpvvkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdxC (C:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqpv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zdxF (F:)
    dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
    rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zdxL (L:)
    dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
    rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec