PDB entry 3zdt

View 3zdt on RCSB PDB site
Description: Crystal structure of basic patch mutant FAK FERM domain FAK31- 405 K216A, K218A, R221A, K222A
Class: transferase
Keywords: transferase, cell adhesion
Deposited on 2012-11-30, released 2012-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.21745
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00944
      • engineered mutation (187)
      • engineered mutation (189)
      • engineered mutation (192-193)
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00944
      • engineered mutation (187)
      • engineered mutation (189)
      • engineered mutation (192-193)
    Domains in SCOPe 2.07: d3zdtb1, d3zdtb2, d3zdtb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zdtB (B:)
    gsgamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrls
    hlqseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffy
    qqvkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffp
    kslldsvaaatlaaliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswii
    svelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapeplt
    vtapsltiaenmadlidgycrlvngatqsfiirpqkegeralpsipklannekqgvrsht
    vsvsetddyaeiideed
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdtB (B:)
    rvlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqsee
    vhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqqvknd
    ymleiadqvdqeialklgcleirrsysnyevlekdvglrrffpkslldsvaaatlaaliq
    qtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisvelaigpeegisyltd
    kganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvtapsltiaenmadlid
    gycrlvngatqsfiirp