PDB entry 3zdg

View 3zdg on RCSB PDB site
Description: Crystal Structure of Ls-AChBP complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (DMABC)
Class: acetylcholine-binding protein
Keywords: acetylcholine-binding protein
Deposited on 2012-11-26, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.1753
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdga_
  • Chain 'B':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgb_
  • Chain 'C':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgc_
  • Chain 'D':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgd_
  • Chain 'E':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdge_
  • Chain 'F':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgf_
  • Chain 'G':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgg_
  • Chain 'H':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgh_
  • Chain 'I':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgi_
  • Chain 'J':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgj_
  • Chain 'K':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgk_
  • Chain 'L':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgl_
  • Chain 'M':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgm_
  • Chain 'N':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgn_
  • Chain 'O':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgo_
  • Chain 'P':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgp_
  • Chain 'Q':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgq_
  • Chain 'R':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgr_
  • Chain 'S':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgs_
  • Chain 'T':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdgt_
  • Heterogens: XRX, SO4, NAG, PEG, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zdgA (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgA (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zdgB (B:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgB (B:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
    ysccpeayedvevslnfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zdgC (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgC (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zdgD (D:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgD (D:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zdgE (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgE (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zdgF (F:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgF (F:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3zdgG (G:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgG (G:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3zdgH (H:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgH (H:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3zdgI (I:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgI (I:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3zdgJ (J:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgJ (J:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3zdgK (K:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgK (K:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3zdgL (L:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgL (L:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3zdgM (M:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgM (M:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3zdgN (N:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgN (N:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpteyfsqysrfeildvtqkknsvtysc
    cpeayedvevslnfrkk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3zdgO (O:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgO (O:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3zdgP (P:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgP (P:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3zdgQ (Q:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgQ (Q:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpteyfsqysrfeildvtqkknsvtysc
    cpeayedvevslnfrkkg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3zdgR (R:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgR (R:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3zdgS (S:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgS (S:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkkg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3zdgT (T:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdgT (T:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg