PDB entry 3zcy

View 3zcy on RCSB PDB site
Description: Ascorbate peroxidase W41A-H42Y mutant
Class: oxidoreductase
Keywords: oxidoreductase, conformational mobility
Deposited on 2012-11-23, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1623
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ascorbate peroxidase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43758 (0-248)
      • engineered mutation (39-40)
    Domains in SCOPe 2.07: d3zcya_
  • Heterogens: HEM, EPE, SO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3zcyA (A:)
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaaysagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada