PDB entry 3zcf

View 3zcf on RCSB PDB site
Description: Structure of recombinant human cytochrome c
Class: electron transport
Keywords: electron transport, respiration, apoptosis, electron transfer
Deposited on 2012-11-20, released 2013-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.17437
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zcfa_
  • Chain 'B':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zcfb_
  • Chain 'C':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zcfc_
  • Chain 'D':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zcfd_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zcfA (A:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zcfB (B:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zcfC (C:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zcfD (D:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne