PDB entry 3zcd

View 3zcd on RCSB PDB site
Description: Native structure of Farnesyl Pyrophosphate Synthase from Pseudomonas aeruginosa PA01.
Class: transferase
Keywords: transferase, fpps
Deposited on 2012-11-19, released 2013-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3zcda1, d3zcda2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3zcdb1, d3zcdb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zcdA (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zcdA (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaa
    kgyalelrdlalaaldgfppsadplrqlaryiverr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zcdB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zcdB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaa
    kgyalelrdlalaaldgfppsadplrqlaryiv