PDB entry 3zc8

View 3zc8 on RCSB PDB site
Description: Crystal Structure of Murraya koenigii Miraculin-Like Protein at 2.2 A resolution at pH 7.0
Class: hydrolase inhibitor
Keywords: hydrolase inhibitor, beta-trefoil fold, kunitz super-family
Deposited on 2012-11-19, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.19548
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor
    Species: MURRAYA KOENIGII [TaxId:311449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zc8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zc8A (A:)
    dplldingnvveasrdyylvsviggaggggltlyrgrnelcpldviqlspdlhkgtrlrf
    aaynntsiiheavdlnvkfstetscneptvwrvdnydpsrgkwfittggvegnpgaqtlk
    nwfklervgtdqgtyeivhcpsvckscvflcndvgvsydyrrrlaltagnervfgvvivp
    anegsascvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zc8A (A:)
    dplldingnvveasrdyylvsviggaggggltlyrgrnelcpldviqlspdlhkgtrlrf
    aaynntsiiheavdlnvkfstetscneptvwrvdnydpsrgkwfittggvegnpgaqtlk
    nwfklervgtdqgtyeivhcpsvckscvflcndvgvsydyrrrlaltagnervfgvvivp
    an