PDB entry 3x3g

View 3x3g on RCSB PDB site
Description: Fab fragment from anti TRAIL-R2 Human Agonist Antibody KMTR2
Class: immune system
Keywords: AGONIST ANTIBODY, anti TRAIL-R2, IMMUNE SYSTEM
Deposited on 2015-01-20, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of KMTR2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3X3G (0-End)
  • Chain 'L':
    Compound: Light chain of KMTR2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3X3G (0-213)
    Domains in SCOPe 2.07: d3x3gl1, d3x3gl2
  • Heterogens: NAG, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x3gL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec