PDB entry 3x3f

View 3x3f on RCSB PDB site
Description: TRAIL-R2 Extracellular Region Complexed to a Fab fragment from Human Agonist Antibody KMTR2
Class: apoptosis/immune system
Keywords: trail-r2, agonist antibody, apoptosis-immune system complex
Deposited on 2015-01-20, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor receptor superfamily member 10B
    Species: Homo sapiens [TaxId:9606]
    Gene: DR5, KILLER, TNFRSF10B, TRAILR2, TRICK2, UNQ160/PRO186, ZTNFR9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3x3fa1, d3x3fa2
  • Chain 'H':
    Compound: Heavy chain of KMTR2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3X3F (0-End)
  • Chain 'L':
    Compound: Light chain of KMTR2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3X3F (0-213)
    Domains in SCOPe 2.07: d3x3fl1, d3x3fl2
  • Heterogens: NAG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3x3fA (A:)
    alitqqdlapqqrvapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkesgsradykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3x3fA (A:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtf
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x3fL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec