PDB entry 3x39

View 3x39 on RCSB PDB site
Description: Domain-swapped dimer of Pseudomonas aeruginosa cytochrome c551
Class: electron transport
Keywords: electron transport
Deposited on 2015-01-16, released 2015-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c-551
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: nirM, PA0518
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3x39a_
  • Chain 'B':
    Compound: cytochrome c-551
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: nirM, PA0518
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3x39b_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x39A (A:)
    edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
    mppnavsddeaqtlakwvlsqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x39B (B:)
    edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
    mppnavsddeaqtlakwvlsqk