PDB entry 3x1z

View 3x1z on RCSB PDB site
Description: Ras-related protein Rap1B(T65A) with GppNHp
Class: signaling protein
Keywords: signal transduction, signaling protein
Deposited on 2014-12-02, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rap-1b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RAP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62636 (0-166)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d3x1za_
  • Chain 'B':
    Compound: Ras-related protein Rap-1b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RAP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62636 (0-166)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d3x1zb_
  • Heterogens: GNP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x1zA (A:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqfaamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqinr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x1zB (B:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqfaamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqinr