PDB entry 3x1x

View 3x1x on RCSB PDB site
Description: Ras-related protein Rap1B with GppNHp
Class: signaling protein
Keywords: signal transduction, signaling protein
Deposited on 2014-12-02, released 2015-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rap-1b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RAP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3x1xa_
  • Heterogens: GNP, MG, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3x1xA (A:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3x1xA (A:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqin