PDB entry 3x1w

View 3x1w on RCSB PDB site
Description: Ras-related protein Rap1B with GDP
Class: signaling protein
Keywords: signal transduction, signaling protein
Deposited on 2014-12-02, released 2015-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rap-1b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RAP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3x1wa_
  • Heterogens: GDP, MG, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x1wA (A:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqinr