PDB entry 3x15

View 3x15 on RCSB PDB site
Description: Dimeric Aquifex aeolicus cytochrome c555
Class: electron transport
Keywords: Electron Transport
Deposited on 2014-10-29, released 2015-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c552
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: cycB2, aq_1550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3x15a_
  • Chain 'D':
    Compound: cytochrome c552
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: cycB2, aq_1550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3x15d_
  • Chain 'G':
    Compound: cytochrome c552
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: cycB2, aq_1550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3x15g_
  • Chain 'J':
    Compound: cytochrome c552
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: cycB2, aq_1550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3x15j_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x15A (A:)
    adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
    mkpqltmlkglsdaelkaladfilshk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x15D (D:)
    adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
    mkpqltmlkglsdaelkaladfilshk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x15G (G:)
    adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
    mkpqltmlkglsdaelkaladfilshk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x15J (J:)
    adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
    mkpqltmlkglsdaelkaladfilshk