PDB entry 3wzf

View 3wzf on RCSB PDB site
Description: Crystal structure of human cytoplasmic aspartate aminotransferase
Class: Transferase
Keywords: Glutamic-oxaloacetic transaminase 1, growth-inhibiting protein 18, cysteine transaminase, cytoplasmic, Transferase
Deposited on 2014-09-24, released 2015-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wzfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wzfA (A:)
    appsvfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqki
    andnslnheylpilglaefrscasrlalgddspalkekrvggvqslggtgalrigadfla
    rwyngtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlena
    pefsivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawai
    ryfvsegfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppa
    qgarivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmf
    sftglnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq