PDB entry 3wyg

View 3wyg on RCSB PDB site
Description: Crystal structure of Xpo1p-PKI-Gsp1p-GTP complex
Class: GTP-binding protein/GTP-binding protein inhibitor
Keywords: heat repeat, nuclear export, GTP-binding protein-GTP-binding protein inhibitor complex
Deposited on 2014-08-26, released 2014-11-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.177
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gsp1p
    Species: Saccharomyces cerevisiae AWRI796 [TaxId:764097]
    Gene: AWRI796_3356
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7KFU1
      • engineered mutation (70)
    Domains in SCOPe 2.04: d3wyga_
  • Chain 'C':
    Compound: Exportin-1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CRM1, G8514, KAP124, XPO1, YGR218W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PKIA, PRKACN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61925
      • engineered mutation (34)
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wygA (A:)
    msapaangevptfklvlvgdggtgkttfvkrhltgefekkyiatigvevhplsfytnfge
    ikfdvwdtaglekfgglrdgyyinaqcaiimfdvtsrityknvpnwhrdlvrvcenipiv
    lcgnkvdvkerkvkaktitfhrkknlqyydisaksnynfekpflwlarklagnpqlefva
    sp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wygA (A:)
    vptfklvlvgdggtgkttfvkrhltgefekkyiatigvevhplsfytnfgeikfdvwdta
    glekfgglrdgyyinaqcaiimfdvtsrityknvpnwhrdlvrvcenipivlcgnkvdvk
    erkvkaktitfhrkknlqyydisaksnynfekpflwlarklagnpqlefv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.