PDB entry 3wxw

View 3wxw on RCSB PDB site
Description: Crystal structure of the human adiponectin receptor 2
Class: membrane protein/immune system
Keywords: PAQR family, Glucose and lipid metabolism, Adiponectin, Osmotin, APPL1, APPL2, membrane, MEMBRANE PROTEIN-IMMUNE SYSTEM complex
Deposited on 2014-08-11, released 2015-04-15
Made obsolete by 6ks1 on 2020-08-19

The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Adiponectin receptor protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: ADIPOR2, PAQR2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86V24 (5-End)
    • expression tag (3-4)
• Chain 'H':
  Compound: V region heavy chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3WXW (0-118)
  Domains in SCOPe 2.05: d3wxwh_
• Chain 'L':
  Compound: V region light chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3WXW (0-106)
  Domains in SCOPe 2.05: d3wxwl_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wxwH (H:)
  evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
  nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wxwL (L:)
  diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
  rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein