PDB entry 3wxw

View 3wxw on RCSB PDB site
Description: Crystal structure of the human adiponectin receptor 2
Class: membrane protein/immune system
Keywords: PAQR family, Glucose and lipid metabolism, Adiponectin, Osmotin, APPL1, APPL2, membrane, MEMBRANE PROTEIN-IMMUNE SYSTEM complex
Deposited on 2014-08-11, released 2015-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adiponectin receptor protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ADIPOR2, PAQR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86V24 (5-End)
      • expression tag (3-4)
  • Chain 'H':
    Compound: V region heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WXW (0-118)
    Domains in SCOPe 2.07: d3wxwh_
  • Chain 'L':
    Compound: V region light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WXW (0-106)
    Domains in SCOPe 2.07: d3wxwl_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wxwH (H:)
    evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
    nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wxwL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein