PDB entry 3wxr

View 3wxr on RCSB PDB site
Description: Yeast 20S proteasome with a mutation of alpha7 subunit
Class: hydrolase
Keywords: UPS, 20S proteasome, hydrolase, protease, 19S regulatory particle, MULTICATALYTIC PROTEASE
Deposited on 2014-08-06, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.177
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit beta type-6
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxr1_
  • Chain '2':
    Compound: Proteasome subunit beta type-7
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxr2_
  • Chain 'A':
    Compound: Proteasome subunit alpha type-1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxra_
  • Chain 'B':
    Compound: Proteasome subunit alpha type-2
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrb_
  • Chain 'C':
    Compound: Proteasome subunit alpha type-3
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrc_
  • Chain 'D':
    Compound: Proteasome subunit alpha type-4
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrd_
  • Chain 'E':
    Compound: Proteasome subunit alpha type-5
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxre_
  • Chain 'F':
    Compound: Proteasome subunit alpha type-6
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrf_
  • Chain 'G':
    Compound: probable proteasome subunit alpha type-7
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21242 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3wxrg1, d3wxrg2
  • Chain 'H':
    Compound: Proteasome subunit beta type-1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrh_
  • Chain 'I':
    Compound: Proteasome subunit beta type-2
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxri_
  • Chain 'J':
    Compound: Proteasome subunit beta type-3
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrj_
  • Chain 'K':
    Compound: Proteasome subunit beta type-4
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrk_
  • Chain 'L':
    Compound: Proteasome subunit beta type-5
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrl_
  • Chain 'M':
    Compound: Proteasome subunit beta type-6
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrm_
  • Chain 'N':
    Compound: Proteasome subunit beta type-7
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrn_
  • Chain 'O':
    Compound: Proteasome subunit alpha type-1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxro_
  • Chain 'P':
    Compound: Proteasome subunit alpha type-2
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha type-3
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrq_
  • Chain 'R':
    Compound: Proteasome subunit alpha type-4
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrr_
  • Chain 'S':
    Compound: Proteasome subunit alpha type-5
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrs_
  • Chain 'T':
    Compound: Proteasome subunit alpha type-6
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrt_
  • Chain 'U':
    Compound: probable proteasome subunit alpha type-7
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21242 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3wxru1, d3wxru2
  • Chain 'V':
    Compound: Proteasome subunit beta type-1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrv_
  • Chain 'W':
    Compound: Proteasome subunit beta type-2
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrw_
  • Chain 'X':
    Compound: Proteasome subunit beta type-3
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrx_
  • Chain 'Y':
    Compound: Proteasome subunit beta type-4
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxry_
  • Chain 'Z':
    Compound: Proteasome subunit beta type-5
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxrz_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3wxr1 (1:)
    matiaseysseasntpiehqfnpygdnggtilgiagedfavlagdtrnitdysinsryep
    kvfdcgdnivmsangfaadgdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkr
    ffpyyvhtiiagldedgkgavysfdpvgsyereqcraggaaaslimpfldnqvnfknqye
    pgtngkvkkplkylsveeviklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkr
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxr1 (1:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3wxr2 (2:)
    mnhdpfswgrpadstygayntqianagaspmvntqqpivtgtsvismkydngviiaadnl
    gsygsllrfngverlipvgdntvvgisgdisdmqhierllkdlvtenaydnpladaeeal
    epsyifeylatvmyqrrskmnplwnaiivagvqsngdqflryvnllgvtyssptlatgfg
    ahmanpllrkvvdresdipkttvqvaeeaivnamrvlyyrdarssrnfslaiidkntglt
    fkknlqvenmkwdfakdikgygtqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxr2 (2:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wxrA (A:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrA (A:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wxrB (B:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrB (B:)
    tdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetl
    skvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqea
    tqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwnd
    eleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsq
    eindrleal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wxrC (C:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrC (C:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkndgevyqkifkpqeikdilvktg
    it
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wxrD (D:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrD (D:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wxrE (E:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrE (E:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegae
    rlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssl
    tlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wxrF (F:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrF (F:)
    rnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkk
    iikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqs
    yggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfiki
    dgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wxrG (G:)
    msvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiqvvd
    rhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlynsvrp
    fgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeglsare
    avkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkeingdd
    dededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrG (G:)
    msvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiqvvd
    rhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlynsvrp
    fgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeglsare
    avkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkein
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wxrH (H:)
    mngiqvdinrlkkgevslgtsimavtfkdgvilgadsrtttgayianrvtdkltrvhdki
    wccrsgsaadtqaiadivqyhlelytsqygtpstetaasvfkelcyenkdnltagiivag
    yddknkgevytiplggsvhklpyaiagsgstfiygycdknfrenmskeetvdfikhslsq
    aikwdgssggvirmvvltaagverlifypdeyeql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrH (H:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3wxrI (I:)
    maglsfdnyqrnnflaenshtqpkatstgttivgvkfnngvviaadtrstqgpivadknc
    aklhrispkiwcagagtaadteavtqligsnielhslytsreprvvsalqmlkqhlfkyq
    ghigaylivagvdptgshlfsihahgstdvgyylslgsgslaamavleshwkqdltkeea
    iklasdaiqagiwndlgsgsnvdvcvmeigkdaeylrnyltpnvreekqksykfprgtta
    vlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrI (I:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3wxrJ (J:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrJ (J:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3wxrK (K:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaqgsgslevlfqgpgsgstmdykdhdgdykdhdidykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrK (K:)
    diilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyiq
    aniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqidy
    lgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgviv
    kivdkdgirqvddfqaq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3wxrL (L:)
    mqaiadsfsvpnrlvkelqydneqnlesdfvtgasqfqrlapsltvppiaspqqflraht
    ddsrnpdckikiahgtttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtm
    aggaadcqfwetwlgsqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgyt
    rkegptiyyvdsdgtrlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaa
    hrdaysggsvnlyhvtedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrL (L:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3wxrM (M:)
    matiaseysseasntpiehqfnpygdnggtilgiagedfavlagdtrnitdysinsryep
    kvfdcgdnivmsangfaadgdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkr
    ffpyyvhtiiagldedgkgavysfdpvgsyereqcraggaaaslimpfldnqvnfknqye
    pgtngkvkkplkylsveeviklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkr
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrM (M:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3wxrN (N:)
    mnhdpfswgrpadstygayntqianagaspmvntqqpivtgtsvismkydngviiaadnl
    gsygsllrfngverlipvgdntvvgisgdisdmqhierllkdlvtenaydnpladaeeal
    epsyifeylatvmyqrrskmnplwnaiivagvqsngdqflryvnllgvtyssptlatgfg
    ahmanpllrkvvdresdipkttvqvaeeaivnamrvlyyrdarssrnfslaiidkntglt
    fkknlqvenmkwdfakdikgygtqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrN (N:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3wxrO (O:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrO (O:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3wxrP (P:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrP (P:)
    tdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetl
    skvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqea
    tqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwnd
    eleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsq
    eindrleal
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3wxrQ (Q:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrQ (Q:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3wxrR (R:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrR (R:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3wxrS (S:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrS (S:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgeeer
    lmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhsslt
    lkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3wxrT (T:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrT (T:)
    rnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkk
    iikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqs
    yggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfiki
    dgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3wxrU (U:)
    msvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiqvvd
    rhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlynsvrp
    fgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeglsare
    avkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkeingdd
    dededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrU (U:)
    msvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiqvvd
    rhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlynsvrp
    fgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeglsare
    avkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkein
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3wxrV (V:)
    mngiqvdinrlkkgevslgtsimavtfkdgvilgadsrtttgayianrvtdkltrvhdki
    wccrsgsaadtqaiadivqyhlelytsqygtpstetaasvfkelcyenkdnltagiivag
    yddknkgevytiplggsvhklpyaiagsgstfiygycdknfrenmskeetvdfikhslsq
    aikwdgssggvirmvvltaagverlifypdeyeql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrV (V:)
    slgtsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiad
    ivqyhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplgg
    svhklpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvv
    ltaagverlifypdeyeql
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3wxrW (W:)
    maglsfdnyqrnnflaenshtqpkatstgttivgvkfnngvviaadtrstqgpivadknc
    aklhrispkiwcagagtaadteavtqligsnielhslytsreprvvsalqmlkqhlfkyq
    ghigaylivagvdptgshlfsihahgstdvgyylslgsgslaamavleshwkqdltkeea
    iklasdaiqagiwndlgsgsnvdvcvmeigkdaeylrnyltpnvreekqksykfprgtta
    vlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrW (W:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3wxrX (X:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrX (X:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3wxrY (Y:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaqgsgslevlfqgpgsgstmdykdhdgdykdhdidykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrY (Y:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3wxrZ (Z:)
    mqaiadsfsvpnrlvkelqydneqnlesdfvtgasqfqrlapsltvppiaspqqflraht
    ddsrnpdckikiahgtttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtm
    aggaadcqfwetwlgsqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgyt
    rkegptiyyvdsdgtrlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaa
    hrdaysggsvnlyhvtedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxrZ (Z:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig