PDB entry 3wxq

View 3wxq on RCSB PDB site
Description: Serial femtosecond X-ray structure of human fatty acid-binding protein type-3 (FABP3) in complex with stearic acid (C18:0) determined using X-ray free-electron laser at SACLA
Class: transport protein
Keywords: antiparallel beta barrel, intracellular transport, heart, TRANSPORT PROTEIN
Deposited on 2014-08-04, released 2014-11-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wxqa_
  • Heterogens: STE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wxqA (A:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyekea