PDB entry 3wxf
View 3wxf on RCSB PDB site
Description: Crystal structure of CYLD USP domain (C596S E674Q) in complex with Met1-linked diubiquitin
Class: hydrolase/protein binding
Keywords: ubiquitin protease, HYDROLASE-PROTEIN BINDING complex
Deposited on
2014-07-30, released
2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-08-16, with a file datestamp of
2017-08-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Uncharacterized protein
Species: Danio rerio [TaxId:7955]
Gene: cyld, cylda
Database cross-references and differences (RAF-indexed):
- Uniprot E7FEV5 (3-End)
- expression tag (2)
- engineered mutation (21)
- engineered mutation (99)
- Uniprot E7FEV5 (Start-311)
- Chain 'B':
Compound: Ubiquitin
Species: Homo sapiens [TaxId:9606]
Gene: UBC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3wxfb1, d3wxfb2 - Chain 'C':
Compound: Uncharacterized protein
Species: Danio rerio [TaxId:7955]
Gene: cyld, cylda
Database cross-references and differences (RAF-indexed):
- Uniprot E7FEV5 (3-End)
- engineered mutation (21)
- engineered mutation (99)
- Uniprot E7FEV5 (Start-311)
- Chain 'D':
Compound: Ubiquitin
Species: Homo sapiens [TaxId:9606]
Gene: UBC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3wxfd1, d3wxfd2 - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3wxfB (B:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
fagkqledgrtlsdyniqkestlhlvlr
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3wxfD (D:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
fagkqledgrtlsdyniqkestlhlvlr