PDB entry 3wxf

View 3wxf on RCSB PDB site
Description: Crystal structure of CYLD USP domain (C596S E674Q) in complex with Met1-linked diubiquitin
Class: hydrolase/protein binding
Keywords: ubiquitin protease, HYDROLASE-PROTEIN BINDING complex
Deposited on 2014-07-30, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Danio rerio [TaxId:7955]
    Gene: cyld, cylda
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7FEV5 (3-End)
      • expression tag (2)
      • engineered mutation (21)
      • engineered mutation (99)
    • Uniprot E7FEV5 (Start-311)
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxfb1, d3wxfb2
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Danio rerio [TaxId:7955]
    Gene: cyld, cylda
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7FEV5 (3-End)
      • engineered mutation (21)
      • engineered mutation (99)
    • Uniprot E7FEV5 (Start-311)
  • Chain 'D':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxfd1, d3wxfd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3wxfB (B:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
fagkqledgrtlsdyniqkestlhlvlr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3wxfD (D:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
fagkqledgrtlsdyniqkestlhlvlr