PDB entry 3wxe

View 3wxe on RCSB PDB site
Description: Crystal structure of CYLD USP domain (C596S) in complex with Met1-linked diubiquitin
Class: hydrolase/protein binding
Keywords: ubiquitin protease, HYDROLASE-PROTEIN BINDING complex
Deposited on 2014-07-30, released 2015-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Danio rerio [TaxId:7955]
    Gene: cyld, cylda
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7FEV5 (3-End)
      • expression tag (2)
      • engineered mutation (21)
    • Uniprot E7FEV5
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wxeb1, d3wxeb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3wxeB (B:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
fagkqledgrtlsdyniqkestlhlvlr