PDB entry 3wwk

View 3wwk on RCSB PDB site
Description: Crystal structure of CLEC-2 in complex with rhodocytin
Class: sugar binding protein
Keywords: C-type lectin fold, Carbohydrate binding, Podoplanin, Rhodocytin, SUGAR BINDING PROTEIN
Deposited on 2014-06-20, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snaclec rhodocytin subunit alpha
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwka_
  • Chain 'B':
    Compound: Snaclec rhodocytin subunit beta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkb_
  • Chain 'C':
    Compound: C-type lectin domain family 1 member B
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC1B, CLEC2, UNQ721/PRO1384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkc_
  • Chain 'D':
    Compound: Snaclec rhodocytin subunit alpha
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkd_
  • Chain 'E':
    Compound: Snaclec rhodocytin subunit beta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwke_
  • Chain 'F':
    Compound: C-type lectin domain family 1 member B
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC1B, CLEC2, UNQ721/PRO1384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkf_
  • Chain 'G':
    Compound: Snaclec rhodocytin subunit alpha
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkg_
  • Chain 'H':
    Compound: Snaclec rhodocytin subunit beta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkh_
  • Chain 'I':
    Compound: C-type lectin domain family 1 member B
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC1B, CLEC2, UNQ721/PRO1384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwki_
  • Chain 'J':
    Compound: Snaclec rhodocytin subunit alpha
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkj_
  • Chain 'K':
    Compound: Snaclec rhodocytin subunit beta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkk_
  • Chain 'L':
    Compound: C-type lectin domain family 1 member B
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC1B, CLEC2, UNQ721/PRO1384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwkl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wwkA (A:)
    gledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisq
    kdeladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvn
    yyceqmhafvckllpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkA (A:)
    ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
    deladedyvwiglraqnkeqqcssewsdgssvsyenllhtkkcgalekltgfrkwvnyyc
    eqmhafvckllpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wwkB (B:)
    mgrfifvsfgllvvflslsgtgadcpsgwssyeghcykpfnepknwadaerfcklqpkhs
    hlvsfqsaeeadfvvkltrprlkanlvwmglsniwhgcnwqwsdgarlnykdwqeqsecl
    afrgvhtewlnmdcsstcsfvckfka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkB (B:)
    dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
    anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
    fka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wwkC (C:)
    gsghksspcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikart
    hlirwvglsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhy
    lmcerkag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkC (C:)
    spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
    glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
    ag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wwkD (D:)
    gledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisq
    kdeladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvn
    yyceqmhafvckllpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkD (D:)
    ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
    deladedyvwiglraqnkeqqcssewsdgssvsyenllhtkkcgalekltgfrkwvnyyc
    eqmhafvckllpy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wwkE (E:)
    mgrfifvsfgllvvflslsgtgadcpsgwssyeghcykpfnepknwadaerfcklqpkhs
    hlvsfqsaeeadfvvkltrprlkanlvwmglsniwhgcnwqwsdgarlnykdwqeqsecl
    afrgvhtewlnmdcsstcsfvckfka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkE (E:)
    dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
    anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
    fka
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wwkF (F:)
    gsghksspcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikart
    hlirwvglsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhy
    lmcerkag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkF (F:)
    spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
    glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
    ag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wwkG (G:)
    gledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisq
    kdeladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvn
    yyceqmhafvckllpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkG (G:)
    ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
    deladedyvwiglraqnkeqqcssewsdgssvsyenllhtkkcgalekltgfrkwvnyyc
    eqmhafvckllpy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wwkH (H:)
    mgrfifvsfgllvvflslsgtgadcpsgwssyeghcykpfnepknwadaerfcklqpkhs
    hlvsfqsaeeadfvvkltrprlkanlvwmglsniwhgcnwqwsdgarlnykdwqeqsecl
    afrgvhtewlnmdcsstcsfvckfka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkH (H:)
    dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
    anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
    fka
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3wwkI (I:)
    gsghksspcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikart
    hlirwvglsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhy
    lmcerkag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkI (I:)
    spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
    glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
    ag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3wwkJ (J:)
    gledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisq
    kdeladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvn
    yyceqmhafvckllpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkJ (J:)
    ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
    dyvwiglraqnkeqqcssewsdgssvsyenllhtkkcgalekltgfrkwvnyyceqmhaf
    vckllpy
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3wwkK (K:)
    mgrfifvsfgllvvflslsgtgadcpsgwssyeghcykpfnepknwadaerfcklqpkhs
    hlvsfqsaeeadfvvkltrprlkanlvwmglsniwhgcnwqwsdgarlnykdwqeqsecl
    afrgvhtewlnmdcsstcsfvckfka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkK (K:)
    dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
    anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
    fka
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3wwkL (L:)
    gsghksspcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikart
    hlirwvglsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhy
    lmcerkag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwkL (L:)
    spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
    glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
    ag