PDB entry 3wvx

View 3wvx on RCSB PDB site
Description: Structure of D48A hen egg white lysozyme
Class: hydrolase
Keywords: O-glycosyl, five helices five beta-strands two antiparallel sheets, Sugar Binding, HYDROLASE
Deposited on 2014-06-10, released 2015-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Gallus gallus [TaxId:9031]
  Gene: LYZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • engineered mutation (47)
  Domains in SCOPe 2.08: d3wvxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wvxA (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntagstdygilqins
  rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
  qawirgcrl