PDB entry 3wu1

View 3wu1 on RCSB PDB site
Description: Crystal structure of the ETS1-RUNX1-DNA ternary complex
Class: transcription/DNA
Keywords: protein-DNA complex, DNA-binding, methylation, nucleus, phosphoprotein, transcription regulation, isopeptide bond, proto-oncogene, transcription-DNA complex
Deposited on 2014-04-21, released 2014-08-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: runt-related transcription factor 1
    Species: Mus musculus [TaxId:10090]
    Gene: Aml1, Cbfa2, Pebp2ab, Runx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wu1a_
  • Chain 'B':
    Compound: Protein C-ets-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ETS1, EWSR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wu1b_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*gp*ap*ap*gp*cp*cp*ap*cp*ap*tp*cp*cp*tp*cp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*ap*gp*ap*gp*gp*ap*tp*gp*tp*gp*gp*cp*tp*tp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3wu1A (A:)
ladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenys
aelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpr
epr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3wu1B (B:)
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdade

    Sequence, based on observed residues (ATOM records): (download) 
    >3wu1B (B:)
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkp

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.