PDB entry 3ws1

View 3ws1 on RCSB PDB site
Description: N288Q-N321Q mutant BETA-LACTAMASE DERIVED FROM CHROMOHALOBACTER SP.560 (Condition-1B)
Class: hydrolase
Keywords: cephalosporinase, hydrolase
Deposited on 2014-02-27, released 2015-03-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Chromohalobacter sp. 560 [TaxId:169132]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76LX5 (Start-366)
      • engineered mutation (287)
      • engineered mutation (320)
    Domains in SCOPe 2.05: d3ws1a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Chromohalobacter sp. 560 [TaxId:169132]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76LX5
      • engineered mutation (287)
      • engineered mutation (320)
    Domains in SCOPe 2.05: d3ws1b_
  • Chain 'C':
    Compound: Beta-lactamase
    Species: Chromohalobacter sp. 560 [TaxId:169132]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76LX5
      • engineered mutation (287)
      • engineered mutation (320)
    Domains in SCOPe 2.05: d3ws1c_
  • Heterogens: CS, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ws1A (A:)
    qddasdrqtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtl
    feigslsktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglpl
    fvpdevtdraslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvl
    aplgmqdtwydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranl
    hladvdaelqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaae
    aleppqsprddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsg
    lgaidvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ws1A (A:)
    qtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtlfeigsls
    ktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglplfvpdevt
    draslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvlaplgmqd
    twydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranlhladvda
    elqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaaealeppqs
    prddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsglgaidvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ws1B (B:)
    qddasdrqtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtl
    feigslsktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglpl
    fvpdevtdraslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvl
    aplgmqdtwydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranl
    hladvdaelqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaae
    aleppqsprddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsg
    lgaidvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ws1B (B:)
    rqtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtlfeigsl
    sktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglplfvpdev
    tdraslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvlaplgmq
    dtwydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranlhladvd
    aelqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaaealeppq
    sprddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsglgaidv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ws1C (C:)
    qddasdrqtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtl
    feigslsktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglpl
    fvpdevtdraslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvl
    aplgmqdtwydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranl
    hladvdaelqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaae
    aleppqsprddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsg
    lgaidvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ws1C (C:)
    rqtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtlfeigsl
    sktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglplfvpdev
    tdraslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvlaplgmq
    dtwydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranlhladvd
    aelqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaaealeppq
    sprddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsglgaidv