PDB entry 3wq9

View 3wq9 on RCSB PDB site
Description: Crystal structure of Hsp90-alpha N-terminal domain in complex with 2-(4-Hydroxy-cyclohexylamino)-4-[5-(4-phenyl-imidazol-1-yl)-isoquinolin-1-yl]-benzamide
Class: chaperone
Keywords: HYDROLASE, ATP Binding, CHAPERONE
Deposited on 2014-01-23, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wq9a_
  • Heterogens: YUK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wq9A (A:)
    hmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldki
    ryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafm
    ealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgep
    mgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq9A (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfveker