PDB entry 3wn5

View 3wn5 on RCSB PDB site
Description: Crystal structure of asymmetrically engineered Fc variant in complex with FcgRIIIa
Class: immune system
Keywords: receptor complex, fc receptor, antibody, immune system
Deposited on 2013-12-05, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.238
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (54)
      • engineered mutation (110)
      • engineered mutation (114)
      • engineered mutation (118)
      • engineered mutation (140)
      • engineered mutation (150)
      • engineered mutation (152)
      • engineered mutation (191)
    Domains in SCOPe 2.07: d3wn5a1, d3wn5a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (19-20)
      • engineered mutation (23)
      • engineered mutation (52)
      • engineered mutation (82)
      • engineered mutation (111)
      • engineered mutation (133)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d3wn5b1, d3wn5b2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A, CD16A, FCG3, FCGR3, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (38)
      • engineered mutation (74)
      • see remark 999 (158)
      • engineered mutation (169)
    Domains in SCOPe 2.07: d3wn5c1, d3wn5c2
  • Chain 'D':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (54)
      • engineered mutation (110)
      • engineered mutation (114)
      • engineered mutation (118)
      • engineered mutation (140)
      • engineered mutation (150)
      • engineered mutation (152)
      • engineered mutation (191)
    Domains in SCOPe 2.07: d3wn5d1, d3wn5d2
  • Chain 'E':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (19-20)
      • engineered mutation (23)
      • engineered mutation (52)
      • engineered mutation (82)
      • engineered mutation (111)
      • engineered mutation (133)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d3wn5e1, d3wn5e2
  • Chain 'F':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A, CD16A, FCG3, FCGR3, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (38)
      • engineered mutation (74)
      • see remark 999 (158)
      • engineered mutation (169)
    Domains in SCOPe 2.07: d3wn5f1, d3wn5f2
  • Heterogens: IOD, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wn5A (A:)
    epkssdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsndalpkpieet
    iskakgqprepqvytlppsrceltknqvslscavkgfypsdiavewesngqpennykttp
    pvldsdgsfflvskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wn5A (A:)
    ellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpr
    eeqynstyrvvsvltvlhqdwlngkeykckvsndalpkpieetiskakgqprepqvytlp
    psrceltknqvslscavkgfypsdiavewesngqpennykttppvldsdgsfflvskltv
    dksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wn5B (B:)
    epkssdkthtcppcpapeyywgpmvflfppkpkdtlmisrtpevtcvvvdvsdedpevkf
    nwyvdgvevhnaktkpreeqynatyrvvsvltvlhqdwlngkeykckvsnkdlpapiekt
    iskakgqprepqvctlppsrdeltknqvslwclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wn5B (B:)
    ywgpmvflfppkpkdtlmisrtpevtcvvvdvsdedpevkfnwyvdgvevhnaktkpree
    qynatyrvvsvltvlhqdwlngkeykckvsnkdlpapiektiskakgqprepqvctlpps
    rdeltknqvslwclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdk
    srwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wn5C (C:)
    mrtedlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfid
    aatvddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalh
    kvtylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititqglavs
    tissffppgyqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wn5C (C:)
    dlpkavvflepqwyrvlekdsvtlkcqgayspqstqwfhneslissqassyfidaatvdd
    sgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylq
    ngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wn5D (D:)
    epkssdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsndalpkpieet
    iskakgqprepqvytlppsrceltknqvslscavkgfypsdiavewesngqpennykttp
    pvldsdgsfflvskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wn5D (D:)
    ellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpr
    eeqynstyrvvsvltvlhqdwlngkeykckvsndalpkpieetiskakgqprepqvytlp
    psrceltknqvslscavkgfypsdiavewesngqpennykttppvldsdgsfflvskltv
    dksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wn5E (E:)
    epkssdkthtcppcpapeyywgpmvflfppkpkdtlmisrtpevtcvvvdvsdedpevkf
    nwyvdgvevhnaktkpreeqynatyrvvsvltvlhqdwlngkeykckvsnkdlpapiekt
    iskakgqprepqvctlppsrdeltknqvslwclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wn5E (E:)
    ywgpmvflfppkpkdtlmisrtpevtcvvvdvsdedpevkfnwyvdgvevhnaktkpree
    qynatyrvvsvltvlhqdwlngkeykckvsnkdlpapiektiskakgqprepqvctlpps
    rdeltknqvslwclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdk
    srwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wn5F (F:)
    mrtedlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfid
    aatvddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalh
    kvtylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititqglavs
    tissffppgyqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wn5F (F:)
    dlpkavvflepqwyrvlekdsvtlkcqgayspqstqwfhneslissqassyfidaatvdd
    sgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylq
    ngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititqg