PDB entry 3wms

View 3wms on RCSB PDB site
Description: The crystal structure of Y195I mutant alpha-cyclodextrin glycosyltransferase from Paenibacillus macerans
Class: transferase
Keywords: Tim barrel, IgG-like beta-barrel, Cyclodextrin glycosyltransferase, TRANSFERASE
Deposited on 2013-11-24, released 2014-11-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-cyclodextrin glucanotransferase
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot S5ZJ19 (31-End)
      • engineered mutation (225)
    Domains in SCOPe 2.06: d3wmsa1, d3wmsa2, d3wmsa3, d3wmsa4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wmsA (A:)
    mkyllptaaagllllaaqpamamdiginsdpspdtsvdnkvnfstdviyqivtdrfadgd
    rtnnpagdafsgdrsnlklyfggdwqgiidkindgyltgmgvtalwisqpvenitsviky
    sgvnntsyhgywardfkqtndafgdfadfqnlidtahahnikvvidfapnhtspadrdnp
    gfaengalydngsllgaysndtaglfhhnggtdfstiedgiyknlidladinhnnnamda
    yfksaidlwlgmgvdgirfdavkhmpfgwqksfvssiyggdhpvftfgewylgadqtdgd
    nikfanesgmnlldfeyaqevrevfrdktetmkdlyevlastesqydyinnmvtfidnhd
    mdrfqvagsgtrateqalaltltsrgvpaiyygteqymtgdgdpnnrammtsfntgttay
    kviqalaplrksnpaiaygttterwvnndvliierkfgssaalvainrnssaaypisgll
    sslpagtysdvlngllngnsitvgsggavtnftlaaggtavwqytapetspaignvgptm
    gqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkvaagktgvsvkts
    sgtasntfksfnvltgdqvtmrflvnqantnygtnvylvgnaaelgswdpnkaigpmynq
    viakypswyydvsvpagtkldfkfikkgggtvtwegggnhtyttpassvgtvtvdwqnle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmsA (A:)
    spdtsvdnkvnfstdviyqivtdrfadgdrtnnpagdafsgdrsnlklyfggdwqgiidk
    indgyltgmgvtalwisqpvenitsvikysgvnntsyhgywardfkqtndafgdfadfqn
    lidtahahnikvvidfapnhtspadrdnpgfaengalydngsllgaysndtaglfhhngg
    tdfstiedgiyknlidladinhnnnamdayfksaidlwlgmgvdgirfdavkhmpfgwqk
    sfvssiyggdhpvftfgewylgadqtdgdnikfanesgmnlldfeyaqevrevfrdktet
    mkdlyevlastesqydyinnmvtfidnhdmdrfqvagsgtrateqalaltltsrgvpaiy
    ygteqymtgdgdpnnrammtsfntgttaykviqalaplrksnpaiaygttterwvnndvl
    iierkfgssaalvainrnssaaypisgllsslpagtysdvlngllngnsitvgsggavtn
    ftlaaggtavwqytapetspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgs
    givswedtqikavipkvaagktgvsvktssgtasntfksfnvltgdqvtmrflvnqantn
    ygtnvylvgnaaelgswdpnkaigpmynqviakypswyydvsvpagtkldfkfikkgggt
    vtwegggnhtyttpassvgtvtvdw