PDB entry 3wmm

View 3wmm on RCSB PDB site
Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in C2 form
Class: photosynthesis
Keywords: photosynthesis
Deposited on 2013-11-22, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm0_
  • Chain '1':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm1_
  • Chain '2':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm2_
  • Chain '3':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm3_
  • Chain '4':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm4_
  • Chain '5':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm5_
  • Chain '6':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm6_
  • Chain '7':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm7_
  • Chain '8':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm8_
  • Chain '9':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmm9_
  • Chain 'A':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmma_
  • Chain 'B':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmb_
  • Chain 'C':
    Compound: Photosynthetic reaction center C subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmc_
  • Chain 'D':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmd_
  • Chain 'E':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmme_
  • Chain 'F':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmf_
  • Chain 'G':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmg_
  • Chain 'H':
    Compound: Photosynthetic reaction center H subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmh1, d3wmmh2
  • Chain 'I':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmi_
  • Chain 'J':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmj_
  • Chain 'K':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmk_
  • Chain 'L':
    Compound: Photosynthetic reaction center L subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Photosynthetic reaction center M subunit
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmm_
  • Chain 'N':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmn_
  • Chain 'O':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmo_
  • Chain 'P':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmp_
  • Chain 'Q':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmq_
  • Chain 'R':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmr_
  • Chain 'S':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmms_
  • Chain 'T':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmt_
  • Chain 'U':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmu_
  • Chain 'V':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmv_
  • Chain 'W':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmw_
  • Chain 'X':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmx_
  • Chain 'Y':
    Compound: LH1 alpha polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmy_
  • Chain 'Z':
    Compound: LH1 beta polypeptide
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wmmz_
  • Heterogens: HEM, CA, BCL, BPH, UQ8, PO4, FE, MQ8, CRT, PGW, PEF, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >3wmm0 (0:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm0 (0:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3wmm1 (1:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm1 (1:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3wmm2 (2:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm2 (2:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3wmm3 (3:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm3 (3:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >3wmm4 (4:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm4 (4:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >3wmm5 (5:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm5 (5:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >3wmm6 (6:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm6 (6:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >3wmm7 (7:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm7 (7:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >3wmm8 (8:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm8 (8:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >3wmm9 (9:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmm9 (9:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wmmA (A:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmA (A:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wmmB (B:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmB (B:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wmmC (C:)
    mspaqqltlpavivvasvmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpve
    slpaadstgpkasevyqnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasdd
    iytkvvsrrmfelvraansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkp
    tgqnygsktvayaslpfdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnis
    dslgvgctfchntrafndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpyg
    dplrvscmtchqavnkplygaqmakdypglyktavtqealagsapaseaapaaateaape
    apaqevpaaeavpaaaepgaaeaagsvepapveevapapaaqrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmC (C:)
    svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy
    qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra
    ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp
    fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf
    ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk
    plygaqmakdypglykt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wmmD (D:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmD (D:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wmmE (E:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmE (E:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wmmF (F:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmF (F:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wmmG (G:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmG (G:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wmmH (H:)
    msagithyidaaqitiwafwlfffgliiylrredkregypldsdrtersggrvkvvgfpd
    lpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspdrp
    khcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepqir
    ylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedkvc
    ayyaggklyataeragpll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmH (H:)
    sagithyidaaqitiwafwlfffgliiylrredkregypldsdrtersggrvkvvgfpdl
    pdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspdrpk
    hcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepqiry
    levevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedkvca
    yyaggklyataeragpll
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3wmmI (I:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmI (I:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3wmmJ (J:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmJ (J:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3wmmK (K:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmK (K:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3wmmM (M:)
    mpeyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtls
    iffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmagl
    fltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgif
    phldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqith
    rgtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavk
    hgmapaypevvtavnpyetaaevmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmM (M:)
    peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
    ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmaglf
    ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
    hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
    gtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavkh
    gmapaypevvtavnpyeta
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3wmmN (N:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmN (N:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3wmmO (O:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmO (O:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3wmmP (P:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmP (P:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3wmmQ (Q:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmQ (Q:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3wmmR (R:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmR (R:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3wmmS (S:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmS (S:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3wmmT (T:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmT (T:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3wmmU (U:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmU (U:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3wmmV (V:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmV (V:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3wmmW (W:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmW (W:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3wmmX (X:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmX (X:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3wmmY (Y:)
    mftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmY (Y:)
    ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3wmmZ (Z:)
    maeqksltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wmmZ (Z:)
    tgltddeakefhaifmqsmyawfglvviahllawlyrpwl