PDB entry 3wj1

View 3wj1 on RCSB PDB site
Description: Crystal structure of SSHESTI
Class: hydrolase
Keywords: alpha/beta-hydrorase fold, carboxylesterase, hydrolase
Deposited on 2013-10-03, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.158
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: SshEstI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wj1a_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wj1A (A:)
    mpldprikkllesgfvvpigkasvdevrkifrqlasaapkaevrkvedikipgsetsina
    rvyfpkakgpygvlvylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfps
    avidsfdatnwiynnldkfdgemgiaiagdsaggnlaavvallskgkldlkyqiliypav
    gfdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspiiaqdlsglppaliit
    aeydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplidqgkdaigligsvlrrt
    fydks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wj1A (A:)
    pldprikkllesgfvvpigkasvdevrkifrqlasaapkaevrkvedikipgsetsinar
    vyfpkakgpygvlvylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa
    vidsfdatnwiynnldkfdgemgiaiagdsaggnlaavvallskgkldlkyqiliypavg
    fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspiiaqdlsglppaliita
    eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplidqgkdaigligsvlrrtf
    ydks