PDB entry 3wii

View 3wii on RCSB PDB site
Description: Crystal structure of the Fab fragment of B2212A, a murine monoclonal antibody specific for the third fibronectin domain (Fn3) of human ROBO1.
Class: immune system
Keywords: Immunoglobulin Fab fragment, anti-hepatocellular carcinoma antibody, the third fibronectin type-III domain (Fn3) of human ROBO1, IMMUNE SYSTEM
Deposited on 2013-09-12, released 2015-01-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-human ROBO1 antibody B2212A Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WII (0-219)
  • Chain 'I':
    Compound: anti-human ROBO1 antibody B2212A Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WII (0-219)
  • Chain 'L':
    Compound: anti-human ROBO1 antibody B2212A Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WII (0-212)
    Domains in SCOPe 2.05: d3wiil1, d3wiil2
  • Chain 'M':
    Compound: anti-human ROBO1 antibody B2212A Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WII (0-212)
    Domains in SCOPe 2.05: d3wiim1, d3wiim2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3wiiL (L:)
diqmtqttsslsaslgdrvtiscrasqdisnflnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdfsltiskleqediatyfcqqgntlpltfgagtklelkraeaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrne

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3wiiM (M:)
diqmtqttsslsaslgdrvtiscrasqdisnflnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdfsltiskleqediatyfcqqgntlpltfgagtklelkraeaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrne