PDB entry 3wif

View 3wif on RCSB PDB site
Description: Crystal structure of anti-prostaglandin E2 Fab fragment 9Cl-PGF2beta complex
Class: immune system
Keywords: immunogloblin, Anti-Prostaglandin E2 antibody, Prostaglandin E2, IMMUNE SYSTEM
Deposited on 2013-09-12, released 2014-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mAb Fab H fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WIF (0-End)
  • Chain 'B':
    Compound: mAb Fab L fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WIF (0-End)
    Domains in SCOPe 2.07: d3wifb1, d3wifb2
  • Heterogens: ON5, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wifB (B:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgiyyclqgshvpltfgagttlelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wifB (B:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgiyyclqgshvpltfgagttlelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr